Lineage for d1dbna_ (1dbn A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12601Species Maackia amurensis, leukoagglutinin [TaxId:37501] [49919] (1 PDB entry)
  8. 12602Domain d1dbna_: 1dbn A: [24155]

Details for d1dbna_

PDB Entry: 1dbn (more details), 2.75 Å

PDB Description: maackia amurensis leukoagglutinin (lectin) with sialyllactose

SCOP Domain Sequences for d1dbna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbna_ b.29.1.1 (A:) Lectin {Maackia amurensis, leukoagglutinin}
sdelsftinnfvpneadllfqgeasvsstgvlqltkvengqpqkysvgralyaapvriwg
nttgsvasfstsftfvvkapnpditsdglafylappdsqipsgsvskylglfnnsnsdss
nqivavefdtyfahsydpwdpnyrhigidvngiesiktvqwdwinggvafatitylapnk
tliaslvypsnqttfsvaasvdlkeilpewvrvgfsaatgyptevethdvlswsftstl

SCOP Domain Coordinates for d1dbna_:

Click to download the PDB-style file with coordinates for d1dbna_.
(The format of our PDB-style files is described here.)

Timeline for d1dbna_: