Lineage for d1dbna_ (1dbn A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. Protein Legume lectin [49904] (23 species)
  7. Species Maackia amurensis, leukoagglutinin [TaxId:37501] [49919] (1 PDB entry)
  8. Domain d1dbna_: 1dbn A: [24155]
    complexed with ca, mn, nag

Details for d1dbna_

PDB Entry: 1dbn (more details), 2.75 Å

PDB Description: maackia amurensis leukoagglutinin (lectin) with sialyllactose
PDB Compounds: (A:) protein (leukoagglutinin)

SCOPe Domain Sequences for d1dbna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]}
sdelsftinnfvpneadllfqgeasvsstgvlqltkvengqpqkysvgralyaapvriwg
nttgsvasfstsftfvvkapnpditsdglafylappdsqipsgsvskylglfnnsnsdss
nqivavefdtyfahsydpwdpnyrhigidvngiesiktvqwdwinggvafatitylapnk
tliaslvypsnqttfsvaasvdlkeilpewvrvgfsaatgyptevethdvlswsftstl

SCOPe Domain Coordinates for d1dbna_ are not available.

Timeline for d1dbna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dbnb_