Lineage for d2dbtc_ (2dbt C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1634020Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 1634021Protein automated matches [190563] (11 species)
    not a true protein
  7. 1634061Species Streptomyces griseus [TaxId:1911] [254952] (3 PDB entries)
  8. 1634066Domain d2dbtc_: 2dbt C: [241549]
    automated match to d2cjla_
    complexed with epe

Details for d2dbtc_

PDB Entry: 2dbt (more details), 3.14 Å

PDB Description: Crystal structure of chitinase C from Streptomyces griseus HUT6037
PDB Compounds: (C:) chitinase C

SCOPe Domain Sequences for d2dbtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dbtc_ d.2.1.0 (C:) automated matches {Streptomyces griseus [TaxId: 1911]}
gfvvseaqfnqmfpnrnafytykgltdalsaypafaktgsdevkkreaaaflanvshetg
glfyikevneanyphycdttqsygcpagqaayygrgpiqlswnfnykaagdalginllan
pylveqdpavawktglwywnsqngpgtmtphnaivnnagfgetirsingalecnggnpaq
vqsrinkftqftqilgtttgpnlsc

SCOPe Domain Coordinates for d2dbtc_:

Click to download the PDB-style file with coordinates for d2dbtc_.
(The format of our PDB-style files is described here.)

Timeline for d2dbtc_: