Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.0: automated matches [191411] (1 protein) not a true family |
Protein automated matches [190563] (18 species) not a true protein |
Species Streptomyces griseus [TaxId:1911] [254952] (3 PDB entries) |
Domain d2dbtb_: 2dbt B: [241548] automated match to d2cjla_ complexed with epe |
PDB Entry: 2dbt (more details), 3.14 Å
SCOPe Domain Sequences for d2dbtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dbtb_ d.2.1.0 (B:) automated matches {Streptomyces griseus [TaxId: 1911]} gfvvseaqfnqmfpnrnafytykgltdalsaypafaktgsdevkkreaaaflanvshetg glfyikevneanyphycdttqsygcpagqaayygrgpiqlswnfnykaagdalginllan pylveqdpavawktglwywnsqngpgtmtphnaivnnagfgetirsingalecnggnpaq vqsrinkftqftqilgtttgpnlsc
Timeline for d2dbtb_: