Lineage for d2dbtb_ (2dbt B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533682Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2533683Protein automated matches [190563] (18 species)
    not a true protein
  7. 2533750Species Streptomyces griseus [TaxId:1911] [254952] (3 PDB entries)
  8. 2533754Domain d2dbtb_: 2dbt B: [241548]
    automated match to d2cjla_
    complexed with epe

Details for d2dbtb_

PDB Entry: 2dbt (more details), 3.14 Å

PDB Description: Crystal structure of chitinase C from Streptomyces griseus HUT6037
PDB Compounds: (B:) chitinase C

SCOPe Domain Sequences for d2dbtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dbtb_ d.2.1.0 (B:) automated matches {Streptomyces griseus [TaxId: 1911]}
gfvvseaqfnqmfpnrnafytykgltdalsaypafaktgsdevkkreaaaflanvshetg
glfyikevneanyphycdttqsygcpagqaayygrgpiqlswnfnykaagdalginllan
pylveqdpavawktglwywnsqngpgtmtphnaivnnagfgetirsingalecnggnpaq
vqsrinkftqftqilgtttgpnlsc

SCOPe Domain Coordinates for d2dbtb_:

Click to download the PDB-style file with coordinates for d2dbtb_.
(The format of our PDB-style files is described here.)

Timeline for d2dbtb_: