Lineage for d2dbta_ (2dbt A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926515Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2926516Protein automated matches [190563] (18 species)
    not a true protein
  7. 2926583Species Streptomyces griseus [TaxId:1911] [254952] (3 PDB entries)
  8. 2926586Domain d2dbta_: 2dbt A: [241547]
    automated match to d2cjla_
    complexed with epe

Details for d2dbta_

PDB Entry: 2dbt (more details), 3.14 Å

PDB Description: Crystal structure of chitinase C from Streptomyces griseus HUT6037
PDB Compounds: (A:) chitinase C

SCOPe Domain Sequences for d2dbta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dbta_ d.2.1.0 (A:) automated matches {Streptomyces griseus [TaxId: 1911]}
gfvvseaqfnqmfpnrnafytykgltdalsaypafaktgsdevkkreaaaflanvshetg
glfyikevneanyphycdttqsygcpagqaayygrgpiqlswnfnykaagdalginllan
pylveqdpavawktglwywnsqngpgtmtphnaivnnagfgetirsingalecnggnpaq
vqsrinkftqftqilgtttgpnlsc

SCOPe Domain Coordinates for d2dbta_:

Click to download the PDB-style file with coordinates for d2dbta_.
(The format of our PDB-style files is described here.)

Timeline for d2dbta_: