SCOPe 2.08: Domain d2dbja1: 2dbj A:8-118

Lineage for d2dbja1 (2dbj A:8-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d2dbja1: 2dbj A:8-118 [241544]
   Other proteins in same PDB: d2dbja2, d2dbja3
   automated match to d1wj3a_

Details for d2dbja1

PDB Entry: 2dbj

PDB Description: solution structures of the fn3 domain of human proto-oncogene tyrosine-protein kinase mer precursor

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase MER precursor

SCOPe Domain Sequences for d2dbja1:

Sequence; same for both SEQRES and ATOM records:

>d2dbja1 b.1.2.0 (A:8-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wilasttegapsvaplnvtvflnessdnvdirwmkpptkqqdgelvgyrishvwqsagis
kelleevgqngsrarisvqvhnatctvriaavtrggvgpfsdpvkifipah

Timeline for d2dbja1:

• d2dbja1 first appeared in SCOPe 2.04, called d2dbja_
  
• d2dbja1 appears in SCOPe 2.07