Lineage for d2dbia_ (2dbi A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071091Family b.82.2.12: YbiU-like [141636] (2 protein domains)
    Pfam PF07350; DUF1479
  6. 2071095Protein automated matches [254509] (1 species)
    not a true protein
  7. 2071096Species Escherichia coli [TaxId:562] [255113] (2 PDB entries)
  8. 2071098Domain d2dbia_: 2dbi A: [241543]
    automated match to d2csga1

Details for d2dbia_

PDB Entry: 2dbi (more details), 2.05 Å

PDB Description: Crystal Structure of a Hypothetical Protein JW0805 from Escherichia coli
PDB Compounds: (A:) Hypothetical protein ybiU

SCOPe Domain Sequences for d2dbia_:

Sequence, based on SEQRES records: (download)

>d2dbia_ b.82.2.12 (A:) automated matches {Escherichia coli [TaxId: 562]}
tftsdtlpadhkaairqmkhalraqlgdvqqifnqlsddiatrvaeinalkaqgdavwpv
lsyadikaghvtaeqreqikrrgcavikghfpreqalgwdqsmldyldrnrfdevykgpg
dnffgtlsasrpeiypiywsqaqmqarqseemanaqsflnrlwtfesdgkqwfnpdvsvi
ypdrirrrppgttskglgahtdsgalerwllpayqrvfanvfngnlaqydpwhaahrtev
eeytvdnttkcsvfrtfqgwtalsdmlpgqgllhvvpipeamayvllrpllddvpedelc
gvapgrvlpvseqwhplliealtsipkleagdsvwwhcdvihsvapvenqqgwgnvmyip
aapmceknlayahkvkaalekgaspgdfpredyetnwegrftladlnihgkralgm

Sequence, based on observed residues (ATOM records): (download)

>d2dbia_ b.82.2.12 (A:) automated matches {Escherichia coli [TaxId: 562]}
tftsdtlpadhkaairqmkhalraqlgdvqqifnqlsddiatrvaeinalkaqgdavwpv
lsyadikaghvtaeqreqikrrgcavikghfpreqalgwdqsmldyldrnrfdevypeiy
piywsqaqmqarqseemanaqsflnrlwtfesdgkqwfnpdvsviypdrirrrppgttsk
glgahtdsgalerwllpayqrvfanvfngnlaqydpwhaahrteveeytvkcsvfrtfqg
wtalsdmlpgqgllhvvpipeamayvllrpllddvpedelcgvapgrvlpvseqwhplli
ealtsipkleagdsvwwhcdvihsvapvenqqgwgnvmyipaapmceknlayahkvkaal
ekgaspgdfpredyetnwegrftladlnihgkralgm

SCOPe Domain Coordinates for d2dbia_:

Click to download the PDB-style file with coordinates for d2dbia_.
(The format of our PDB-style files is described here.)

Timeline for d2dbia_: