SCOPe 2.07: Domain d2db8a1: 2db8 A:8-104

Lineage for d2db8a1 (2db8 A:8-104)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (56 PDB entries)

8. Domain d2db8a1: 2db8 A:8-104 [241542]
   Other proteins in same PDB: d2db8a2, d2db8a3
   automated match to d1uema_

Details for d2db8a1

PDB Entry: 2db8

PDB Description: Solution structures of the fn3 domain of human Tripartite motif protein 9

PDB Compounds: (A:) Tripartite motif protein 9, isoform 2

SCOPe Domain Sequences for d2db8a1:

Sequence; same for both SEQRES and ATOM records:

>d2db8a1 b.1.2.0 (A:8-104) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvpatpilqleeccthnnsatlswkqpplstvpadgyilelddgnggqfrevyvgketmc
tvdglhfnstynarvkafnktgvspysktlvlqtseg

Timeline for d2db8a1:

• d2db8a1 first appeared in SCOPe 2.04, called d2db8a_
  
• d2db8a1 appears in SCOPe 2.06