Lineage for d1qotd_ (1qot D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 555834Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 555962Protein Legume lectin [49904] (23 species)
  7. 556039Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)
  8. 556057Domain d1qotd_: 1qot D: [24154]

Details for d1qotd_

PDB Entry: 1qot (more details), 3 Å

PDB Description: lectin uea-ii complexed with fucosyllactose and fucosylgalactose

SCOP Domain Sequences for d1qotd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qotd_ b.29.1.1 (D:) Legume lectin {Furze (Ulex europaeus), UEA-II}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

SCOP Domain Coordinates for d1qotd_:

Click to download the PDB-style file with coordinates for d1qotd_.
(The format of our PDB-style files is described here.)

Timeline for d1qotd_: