SCOP 1.67: Domain d1qotd_: 1qot D:

Lineage for d1qotd_ (1qot D:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)

8. Domain d1qotd_: 1qot D: [24154]

Details for d1qotd_

PDB Entry: 1qot, 3 Å

PDB Description: lectin uea-ii complexed with fucosyllactose and fucosylgalactose

SCOP Domain Sequences for d1qotd_:

Sequence; same for both SEQRES and ATOM records:

>d1qotd_ b.29.1.1 (D:) Legume lectin {Furze (Ulex europaeus), UEA-II}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

Timeline for d1qotd_:

• d1qotd_ first appeared (with stable ids) in SCOP 1.55
  
• d1qotd_ appears in SCOP 1.65
  
• d1qotd_ appears in SCOP 1.69
  
• d1qotd_ appears in the current release, SCOPe 2.08