SCOPe 2.06: Domain d2data1: 2dat A:8-117

Lineage for d2data1 (2dat A:8-117)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)

8. Domain d2data1: 2dat A:8-117 [241539]
   Other proteins in same PDB: d2data2, d2data3
   automated match to d3uvda_

Details for d2data1

PDB Entry: 2dat

PDB Description: solution structure of the bromodomain of human swi/snf related matrix associated actin dependent regulator of cromatin subfamily a member 2

PDB Compounds: (A:) Possible global transcription activator SNF2L2

SCOPe Domain Sequences for d2data1:

Sequence; same for both SEQRES and ATOM records:

>d2data1 a.29.2.0 (A:8-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvdfkkike
rirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarq

Timeline for d2data1:

• d2data1 first appeared in SCOPe 2.04, called d2data_
  
• d2data1 was called d2data_ in SCOPe 2.05
  
• d2data1 appears in SCOPe 2.07
  
• d2data1 appears in the current release, SCOPe 2.08