Lineage for d2data_ (2dat A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1487718Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1487790Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1487791Protein automated matches [190615] (4 species)
    not a true protein
  7. 1487795Species Human (Homo sapiens) [TaxId:9606] [187641] (182 PDB entries)
  8. 1488059Domain d2data_: 2dat A: [241539]
    automated match to d3uvda_

Details for d2data_

PDB Entry: 2dat (more details)

PDB Description: solution structure of the bromodomain of human swi/snf related matrix associated actin dependent regulator of cromatin subfamily a member 2
PDB Compounds: (A:) Possible global transcription activator SNF2L2

SCOPe Domain Sequences for d2data_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2data_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgspnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpv
dfkkikerirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarqsgp
ssg

SCOPe Domain Coordinates for d2data_:

Click to download the PDB-style file with coordinates for d2data_.
(The format of our PDB-style files is described here.)

Timeline for d2data_: