Lineage for d2data1 (2dat A:8-117)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2708290Domain d2data1: 2dat A:8-117 [241539]
    Other proteins in same PDB: d2data2, d2data3
    automated match to d3uvda_

Details for d2data1

PDB Entry: 2dat (more details)

PDB Description: solution structure of the bromodomain of human swi/snf related matrix associated actin dependent regulator of cromatin subfamily a member 2
PDB Compounds: (A:) Possible global transcription activator SNF2L2

SCOPe Domain Sequences for d2data1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2data1 a.29.2.0 (A:8-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvdfkkike
rirnhkyrslgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarq

SCOPe Domain Coordinates for d2data1:

Click to download the PDB-style file with coordinates for d2data1.
(The format of our PDB-style files is described here.)

Timeline for d2data1: