![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.2: UBA-like [46934] (5 families) ![]() |
![]() | Family a.5.2.0: automated matches [254220] (1 protein) not a true family |
![]() | Protein automated matches [254501] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255112] (2 PDB entries) |
![]() | Domain d2daka1: 2dak A:8-57 [241538] Other proteins in same PDB: d2daka2, d2daka3 automated match to d1whca_ |
PDB Entry: 2dak (more details)
SCOPe Domain Sequences for d2daka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2daka1 a.5.2.0 (A:8-57) automated matches {Human (Homo sapiens) [TaxId: 9606]} ppedcvttivsmgfsrdqalkalratnnsleravdwifshiddldaeaam
Timeline for d2daka1: