Lineage for d2daka1 (2dak A:8-57)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308343Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2308367Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2308550Family a.5.2.0: automated matches [254220] (1 protein)
    not a true family
  6. 2308551Protein automated matches [254501] (2 species)
    not a true protein
  7. 2308552Species Human (Homo sapiens) [TaxId:9606] [255112] (2 PDB entries)
  8. 2308553Domain d2daka1: 2dak A:8-57 [241538]
    Other proteins in same PDB: d2daka2, d2daka3
    automated match to d1whca_

Details for d2daka1

PDB Entry: 2dak (more details)

PDB Description: Solution Structure of the Second UBA Domain in the Human Ubiquitin Specific Protease 5 (Isopeptidase 5)
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 5

SCOPe Domain Sequences for d2daka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2daka1 a.5.2.0 (A:8-57) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppedcvttivsmgfsrdqalkalratnnsleravdwifshiddldaeaam

SCOPe Domain Coordinates for d2daka1:

Click to download the PDB-style file with coordinates for d2daka1.
(The format of our PDB-style files is described here.)

Timeline for d2daka1: