SCOPe 2.04: Domain d2daga_: 2dag A:

Lineage for d2daga_ (2dag A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.0: automated matches [254220] (1 protein)
   not a true family

6. Protein automated matches [254501] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255112] (2 PDB entries)

8. Domain d2daga_: 2dag A: [241537]
   automated match to d1whca_

Details for d2daga_

PDB Entry: 2dag

PDB Description: solution structure of the first uba domain in the human ubiquitin specific protease 5 (isopeptidase 5)

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 5

SCOPe Domain Sequences for d2daga_:

Sequence; same for both SEQRES and ATOM records:

>d2daga_ a.5.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgldesviiqlvemgfpmdacrkavyytgnsgaeaamnwvmshmddpdfanplil
pgssgpgssgpssg

Timeline for d2daga_:

• d2daga_ is new in SCOPe 2.04-stable
  
• d2daga_ appears in SCOPe 2.05
  
• d2daga_ appears in the current release, SCOPe 2.08, called d2daga1