Lineage for d2daga1 (2dag A:8-68)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696224Family a.5.2.0: automated matches [254220] (1 protein)
    not a true family
  6. 2696225Protein automated matches [254501] (2 species)
    not a true protein
  7. 2696226Species Human (Homo sapiens) [TaxId:9606] [255112] (2 PDB entries)
  8. 2696228Domain d2daga1: 2dag A:8-68 [241537]
    Other proteins in same PDB: d2daga2, d2daga3
    automated match to d1whca_

Details for d2daga1

PDB Entry: 2dag (more details)

PDB Description: solution structure of the first uba domain in the human ubiquitin specific protease 5 (isopeptidase 5)
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 5

SCOPe Domain Sequences for d2daga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2daga1 a.5.2.0 (A:8-68) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldesviiqlvemgfpmdacrkavyytgnsgaeaamnwvmshmddpdfanplilpgssgpg
s

SCOPe Domain Coordinates for d2daga1:

Click to download the PDB-style file with coordinates for d2daga1.
(The format of our PDB-style files is described here.)

Timeline for d2daga1: