Lineage for d2dada1 (2dad A:8-87)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773666Species Human (Homo sapiens) [TaxId:9606] [230909] (14 PDB entries)
  8. 2773689Domain d2dada1: 2dad A:8-87 [241536]
    Other proteins in same PDB: d2dada2, d2dada3
    automated match to d4fd9a_

Details for d2dada1

PDB Entry: 2dad (more details)

PDB Description: solution structure of the fifth crystall domain of the non-lens protein, absent in melanoma 1
PDB Compounds: (A:) Absent in melanoma 1 protein

SCOPe Domain Sequences for d2dada1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dada1 b.11.1.0 (A:8-87) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qihlfsepqfqghsqsfeettsqiddsfstkscrvsggswvvydgenftgnqyvleeghy
pclsamgcppgatfkslrfi

SCOPe Domain Coordinates for d2dada1:

Click to download the PDB-style file with coordinates for d2dada1.
(The format of our PDB-style files is described here.)

Timeline for d2dada1: