Lineage for d2da6a1 (2da6 A:8-96)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691970Protein automated matches [190360] (3 species)
    not a true protein
  7. 2691983Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries)
  8. 2691996Domain d2da6a1: 2da6 A:8-96 [241534]
    Other proteins in same PDB: d2da6a2, d2da6a3
    automated match to d1lfba_

Details for d2da6a1

PDB Entry: 2da6 (more details)

PDB Description: solution structure of the homeobox domain of hepatocyte nuclear factor 1-beta (hnf-1beta)
PDB Compounds: (A:) Hepatocyte nuclear factor 1-beta

SCOPe Domain Sequences for d2da6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2da6a1 a.4.1.1 (A:8-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnrfkwgpasqqilyqaydrqknpskeerealveecnraeclqrgvspskahglgsnlvt
evrvynwfanrrkeeafrqklamdayssn

SCOPe Domain Coordinates for d2da6a1:

Click to download the PDB-style file with coordinates for d2da6a1.
(The format of our PDB-style files is described here.)

Timeline for d2da6a1: