![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein automated matches [190360] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries) |
![]() | Domain d2da6a1: 2da6 A:8-96 [241534] Other proteins in same PDB: d2da6a2, d2da6a3 automated match to d1lfba_ |
PDB Entry: 2da6 (more details)
SCOPe Domain Sequences for d2da6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2da6a1 a.4.1.1 (A:8-96) automated matches {Human (Homo sapiens) [TaxId: 9606]} rnrfkwgpasqqilyqaydrqknpskeerealveecnraeclqrgvspskahglgsnlvt evrvynwfanrrkeeafrqklamdayssn
Timeline for d2da6a1: