Lineage for d1qotc_ (1qot C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388157Protein Legume lectin [49904] (23 species)
  7. 2388238Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)
  8. 2388255Domain d1qotc_: 1qot C: [24153]
    complexed with ca, mn, nag

Details for d1qotc_

PDB Entry: 1qot (more details), 3 Å

PDB Description: lectin uea-ii complexed with fucosyllactose and fucosylgalactose
PDB Compounds: (C:) chitin binding lectin, uea-II

SCOPe Domain Sequences for d1qotc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qotc_ b.29.1.1 (C:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

SCOPe Domain Coordinates for d1qotc_:

Click to download the PDB-style file with coordinates for d1qotc_.
(The format of our PDB-style files is described here.)

Timeline for d1qotc_: