SCOPe 2.05: Domain d2d9ua_: 2d9u A:

Lineage for d2d9ua_ (2d9u A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein automated matches [191035] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188859] (13 PDB entries)

8. Domain d2d9ua_: 2d9u A: [241527]
   automated match to d2dnta1

Details for d2d9ua_

PDB Entry: 2d9u

PDB Description: solution structure of the chromo domain of chromobox homolog 2 from human

PDB Compounds: (A:) Chromobox protein homolog 2 (isoform 2)

SCOPe Domain Sequences for d2d9ua_:

Sequence; same for both SEQRES and ATOM records:

>d2d9ua_ b.34.13.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgeqvfaaecilskrlrkgkleylvkwrgwsskhnswepeenildprlllafqkk
ehekevqnsgpssg

Timeline for d2d9ua_:

• d2d9ua_ first appeared in SCOPe 2.04
  
• d2d9ua_ is called d2d9ua1 in SCOPe 2.06
  
• d2d9ua_ appears in the current release, SCOPe 2.08, called d2d9ua1