![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
![]() | Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
![]() | Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
![]() | Protein automated matches [190464] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries) |
![]() | Domain d2d9ja1: 2d9j A:8-133 [241525] Other proteins in same PDB: d2d9ja2, d2d9ja3 automated match to d2a72a_ |
PDB Entry: 2d9j (more details)
SCOPe Domain Sequences for d2d9ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d9ja1 a.91.1.0 (A:8-133) automated matches {Human (Homo sapiens) [TaxId: 9606]} sqqrvkrwgfgmdealkdpvgreqflkflesefssenlrfwlavedlkkrpikevpsrvq eiwqeflapgapsainldsksydktthnvkepgrytfedaqehiyklmksdsyprfirss ayqell
Timeline for d2d9ja1: