Lineage for d2d9ja1 (2d9j A:8-133)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004960Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2004961Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2005022Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2005023Protein automated matches [190464] (3 species)
    not a true protein
  7. 2005032Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries)
  8. 2005070Domain d2d9ja1: 2d9j A:8-133 [241525]
    Other proteins in same PDB: d2d9ja2, d2d9ja3
    automated match to d2a72a_

Details for d2d9ja1

PDB Entry: 2d9j (more details)

PDB Description: solution structure of the rgs domain of regulator of g-protein signaling 7
PDB Compounds: (A:) Regulator of G-protein signalling 7

SCOPe Domain Sequences for d2d9ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d9ja1 a.91.1.0 (A:8-133) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqqrvkrwgfgmdealkdpvgreqflkflesefssenlrfwlavedlkkrpikevpsrvq
eiwqeflapgapsainldsksydktthnvkepgrytfedaqehiyklmksdsyprfirss
ayqell

SCOPe Domain Coordinates for d2d9ja1:

Click to download the PDB-style file with coordinates for d2d9ja1.
(The format of our PDB-style files is described here.)

Timeline for d2d9ja1: