SCOPe 2.07: Domain d2d9fa1: 2d9f A:8-129

Lineage for d2d9fa1 (2d9f A:8-129)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries)

8. Domain d2d9fa1: 2d9f A:8-129 [241524]
   Other proteins in same PDB: d2d9fa2, d2d9fa3
   automated match to d2awga_

Details for d2d9fa1

PDB Entry: 2d9f

PDB Description: solution structure of ruh-047, an fkbp domain from human cdna

PDB Compounds: (A:) FK506-binding protein 8 variant

SCOPe Domain Sequences for d2d9fa1:

Sequence; same for both SEQRES and ATOM records:

>d2d9fa1 d.26.1.0 (A:8-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eewldilgngllrkktlvpgppgssrpvkgqvvtvhlqtslengtrvqeepelvftlgdc
dviqaldlsvplmdvgetamvtadskycygpqgsrspyipphaalclevtlktavdrpdl
em

Timeline for d2d9fa1:

• d2d9fa1 first appeared in SCOPe 2.04, called d2d9fa_
  
• d2d9fa1 appears in SCOPe 2.06
  
• d2d9fa1 appears in the current release, SCOPe 2.08