Lineage for d2d9ea1 (2d9e A:8-115)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2708287Domain d2d9ea1: 2d9e A:8-115 [241523]
    Other proteins in same PDB: d2d9ea2, d2d9ea3
    automated match to d3rcwb_

Details for d2d9ea1

PDB Entry: 2d9e (more details)

PDB Description: solution structure of the bromodomain of peregrin
PDB Compounds: (A:) Peregrin

SCOPe Domain Sequences for d2d9ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d9ea1 a.29.2.0 (A:8-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
flillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayrylnfdd
feedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg

SCOPe Domain Coordinates for d2d9ea1:

Click to download the PDB-style file with coordinates for d2d9ea1.
(The format of our PDB-style files is described here.)

Timeline for d2d9ea1: