SCOPe 2.04: Domain d2d9ca_: 2d9c A:

Lineage for d2d9ca_ (2d9c A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d2d9ca_: 2d9c A: [241522]
   automated match to d4cmma_

Details for d2d9ca_

PDB Entry: 2d9c

PDB Description: solution structure of the first ig-like domain of signal-regulatory protein beta-1 (sirp-beta-1)

PDB Compounds: (A:) Signal-regulatory protein beta-1

SCOPe Domain Sequences for d2d9ca_:

Sequence; same for both SEQRES and ATOM records:

>d2d9ca_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgelqviqpeksvsvaagesatlrcamtslipvgpimwfrgagagreliynqkeg
hfprvttvseltkrnnldfsisisnitpadagtyycvkfrkgspddvefksgagtelsvr
akpsapvvsgsgpssg

Timeline for d2d9ca_:

• d2d9ca_ is new in SCOPe 2.04-stable
  
• d2d9ca_ appears in SCOPe 2.05
  
• d2d9ca_ appears in the current release, SCOPe 2.08, called d2d9ca1