Lineage for d2d9ca1 (2d9c A:8-130)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2759366Domain d2d9ca1: 2d9c A:8-130 [241522]
    Other proteins in same PDB: d2d9ca2, d2d9ca3
    automated match to d4cmma_

Details for d2d9ca1

PDB Entry: 2d9c (more details)

PDB Description: solution structure of the first ig-like domain of signal-regulatory protein beta-1 (sirp-beta-1)
PDB Compounds: (A:) Signal-regulatory protein beta-1

SCOPe Domain Sequences for d2d9ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d9ca1 b.1.1.0 (A:8-130) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elqviqpeksvsvaagesatlrcamtslipvgpimwfrgagagreliynqkeghfprvtt
vseltkrnnldfsisisnitpadagtyycvkfrkgspddvefksgagtelsvrakpsapv
vsg

SCOPe Domain Coordinates for d2d9ca1:

Click to download the PDB-style file with coordinates for d2d9ca1.
(The format of our PDB-style files is described here.)

Timeline for d2d9ca1: