Lineage for d2d9aa_ (2d9a A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1477566Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1478383Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1478384Protein automated matches [190674] (14 species)
    not a true protein
  7. 1478431Species Mouse (Mus musculus) [TaxId:10090] [188321] (5 PDB entries)
  8. 1478443Domain d2d9aa_: 2d9a A: [241520]
    automated match to d1mbea_

Details for d2d9aa_

PDB Entry: 2d9a (more details)

PDB Description: solution structure of rsgi ruh-050, a myb dna-binding domain in mouse cdna
PDB Compounds: (A:) Myb-related protein B

SCOPe Domain Sequences for d2d9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d9aa_ a.4.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgkvkwtheedeqlralvrqfgqqdwkflashfpnrtdqqcqyrwlrvlsgpssg

SCOPe Domain Coordinates for d2d9aa_:

Click to download the PDB-style file with coordinates for d2d9aa_.
(The format of our PDB-style files is described here.)

Timeline for d2d9aa_: