SCOP 1.73: Domain d1qotb_: 1qot B:

Lineage for d1qotb_ (1qot B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)

8. Domain d1qotb_: 1qot B: [24152]

Details for d1qotb_

PDB Entry: 1qot, 3 Å

PDB Description: lectin uea-ii complexed with fucosyllactose and fucosylgalactose

PDB Compounds: (B:) chitin binding lectin, uea-II

SCOP Domain Sequences for d1qotb_:

Sequence; same for both SEQRES and ATOM records:

>d1qotb_ b.29.1.1 (B:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

Timeline for d1qotb_:

• d1qotb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qotb_ appears in SCOP 1.71
  
• d1qotb_ appears in SCOP 1.75
  
• d1qotb_ appears in the current release, SCOPe 2.08