Lineage for d1qotb_ (1qot B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 57553Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 57658Protein Legume lectin [49904] (18 species)
  7. 57691Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)
  8. 57707Domain d1qotb_: 1qot B: [24152]

Details for d1qotb_

PDB Entry: 1qot (more details), 3 Å

PDB Description: lectin uea-ii complexed with fucosyllactose and fucosylgalactose

SCOP Domain Sequences for d1qotb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qotb_ b.29.1.1 (B:) Legume lectin {Furze (Ulex europaeus), UEA-II}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

SCOP Domain Coordinates for d1qotb_:

Click to download the PDB-style file with coordinates for d1qotb_.
(The format of our PDB-style files is described here.)

Timeline for d1qotb_: