![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein Legume lectin [49904] (23 species) |
![]() | Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries) |
![]() | Domain d1qotb_: 1qot B: [24152] complexed with ca, mn, nag |
PDB Entry: 1qot (more details), 3 Å
SCOPe Domain Sequences for d1qotb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qotb_ b.29.1.1 (B:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
Timeline for d1qotb_: