Lineage for d2d92a1 (2d92 A:8-102)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2396113Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2396114Protein automated matches [190436] (9 species)
    not a true protein
  7. 2396128Species Human (Homo sapiens) [TaxId:9606] [187333] (105 PDB entries)
  8. 2396289Domain d2d92a1: 2d92 A:8-102 [241518]
    Other proteins in same PDB: d2d92a2, d2d92a3
    automated match to d1wfva_

Details for d2d92a1

PDB Entry: 2d92 (more details)

PDB Description: solution structure of the fifth pdz domain of inad-like protein
PDB Compounds: (A:) InaD-like protein

SCOPe Domain Sequences for d2d92a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d92a1 b.36.1.0 (A:8-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elalwspevkivelvkdckglgfsildyqdpldptrsvivirslvadgvaersggllpgd
rlvsvneycldntslaeaveilkavppglvhlgic

SCOPe Domain Coordinates for d2d92a1:

Click to download the PDB-style file with coordinates for d2d92a1.
(The format of our PDB-style files is described here.)

Timeline for d2d92a1: