Class a: All alpha proteins [46456] (285 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
Protein automated matches [226856] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224978] (24 PDB entries) |
Domain d2d89a_: 2d89 A: [241513] automated match to d1bkra_ |
PDB Entry: 2d89 (more details)
SCOPe Domain Sequences for d2d89a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d89a_ a.40.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gssgssgpnasqsllvwckevtknyrgvkitnfttswrnglsfcailhhfrpdlidyksl npqdikennkkaydgfasigisrllepsdmvllaipdkltvmtylyqirahfssgpssg
Timeline for d2d89a_: