SCOPe 2.05: Domain d2d85a_: 2d85 A:

Lineage for d2d85a_ (2d85 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
   Pfam PF00307

6. Protein automated matches [191021] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188812] (7 PDB entries)

8. Domain d2d85a_: 2d85 A: [241509]
   automated match to d1wjoa_

Details for d2d85a_

PDB Entry: 2d85

PDB Description: solution structure of the fourth ch domain from human l-plastin

PDB Compounds: (A:) L-plastin

SCOPe Domain Sequences for d2d85a_:

Sequence; same for both SEQRES and ATOM records:

>d2d85a_ a.40.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgnddiivnwvnetlreaeksssissfkdpkistslpvldlidaiqpgsinydll
ktenlnddeklnnakyaismarkigarvyalpedlvevnpkmvmtvfaclmgkgmkrvsg
pssg

Timeline for d2d85a_:

• d2d85a_ first appeared in SCOPe 2.04
  
• d2d85a_ is called d2d85a1 in SCOPe 2.06
  
• d2d85a_ appears in the current release, SCOPe 2.08, called d2d85a1