Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (4 families) |
Family b.40.6.0: automated matches [254223] (1 protein) not a true family |
Protein automated matches [254506] (2 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:53953] [255108] (1 PDB entry) |
Domain d2d62a2: 2d62 A:244-304 [241507] Other proteins in same PDB: d2d62a1 automated match to d1g2913 complexed with pop, so4 |
PDB Entry: 2d62 (more details), 2.1 Å
SCOPe Domain Sequences for d2d62a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d62a2 b.40.6.0 (A:244-304) automated matches {Pyrococcus horikoshii [TaxId: 53953]} gsppmnfldatitddgfldfgefklkllqdqfevleeenmvgkevifgirpedvhdasft h
Timeline for d2d62a2: