| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (2 families) ![]() automatically mapped to Pfam PF02203 |
| Family a.24.2.0: automated matches [254222] (1 protein) not a true family |
| Protein automated matches [254505] (2 species) not a true protein |
| Species Escherichia coli [TaxId:562] [255106] (1 PDB entry) |
| Domain d2d4ub_: 2d4u B: [241505] automated match to d2asra_ |
PDB Entry: 2d4u (more details), 1.95 Å
SCOPe Domain Sequences for d2d4ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d4ub_ a.24.2.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
nalknckenftvlqtirqqqstlngswvallqtrntlnragirymmdqnnigsgstvael
mesasislkqaeknwadyealprdprqstaaaaeikrnydiyhnalaeliqllgagkine
ffdqptqgyqdgfekqyvaymeqndrlhdiavsdn
Timeline for d2d4ub_: