Lineage for d2d4ub_ (2d4u B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699469Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (2 families) (S)
    automatically mapped to Pfam PF02203
  5. 2699485Family a.24.2.0: automated matches [254222] (1 protein)
    not a true family
  6. 2699486Protein automated matches [254505] (3 species)
    not a true protein
  7. 2699490Species Escherichia coli [TaxId:562] [255106] (1 PDB entry)
  8. 2699492Domain d2d4ub_: 2d4u B: [241505]
    Other proteins in same PDB: d2d4ua2
    automated match to d2asra_

Details for d2d4ub_

PDB Entry: 2d4u (more details), 1.95 Å

PDB Description: crystal structure of the ligand binding domain of the bacterial serine chemoreceptor tsr
PDB Compounds: (B:) methyl-accepting chemotaxis protein I

SCOPe Domain Sequences for d2d4ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d4ub_ a.24.2.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
nalknckenftvlqtirqqqstlngswvallqtrntlnragirymmdqnnigsgstvael
mesasislkqaeknwadyealprdprqstaaaaeikrnydiyhnalaeliqllgagkine
ffdqptqgyqdgfekqyvaymeqndrlhdiavsdn

SCOPe Domain Coordinates for d2d4ub_:

Click to download the PDB-style file with coordinates for d2d4ub_.
(The format of our PDB-style files is described here.)

Timeline for d2d4ub_: