SCOPe 2.08: Domain d2d4ha2: 2d4h A:284-316

Lineage for d2d4ha2 (2d4h A:284-316)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.114: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48339] (1 superfamily)
   multihelical; bundle of longer and shorter helices

4. Superfamily a.114.1: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48340] (2 families)
   automatically mapped to Pfam PF02841

5. Family a.114.1.0: automated matches [230517] (1 protein)
   not a true family

6. Protein automated matches [230518] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230519] (6 PDB entries)

8. Domain d2d4ha2: 2d4h A:284-316 [241502]
   Other proteins in same PDB: d2d4ha1, d2d4hb1
   automated match to d2b8wb2
   complexed with 5gp

Details for d2d4ha2

PDB Entry: 2d4h, 2.9 Å

PDB Description: crystal-structure of the n-terminal large gtpase domain of human guanylate binding protein 1 (hgbp1) in complex with gmp

PDB Compounds: (A:) interferon-induced guanylate-binding protein 1

SCOPe Domain Sequences for d2d4ha2:

Sequence; same for both SEQRES and ATOM records:

>d2d4ha2 a.114.1.0 (A:284-316) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggiqvngprleslvltyvnaissgdlpcmenav

Timeline for d2d4ha2:

• d2d4ha2 first appeared in SCOPe 2.04
  
• d2d4ha2 appears in SCOPe 2.07