![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.114: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48339] (1 superfamily) multihelical; bundle of longer and shorter helices |
![]() | Superfamily a.114.1: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48340] (2 families) ![]() automatically mapped to Pfam PF02841 |
![]() | Family a.114.1.0: automated matches [230517] (1 protein) not a true family |
![]() | Protein automated matches [230518] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [230519] (6 PDB entries) |
![]() | Domain d2d4ha2: 2d4h A:284-316 [241502] Other proteins in same PDB: d2d4ha1, d2d4hb1 automated match to d2b8wb2 complexed with 5gp |
PDB Entry: 2d4h (more details), 2.9 Å
SCOPe Domain Sequences for d2d4ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d4ha2 a.114.1.0 (A:284-316) automated matches {Human (Homo sapiens) [TaxId: 9606]} ggiqvngprleslvltyvnaissgdlpcmenav
Timeline for d2d4ha2: