Lineage for d1dzqd_ (1dzq D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12521Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)
  8. 12533Domain d1dzqd_: 1dzq D: [24150]

Details for d1dzqd_

PDB Entry: 1dzq (more details), 2.85 Å

PDB Description: lectin uea-ii complexed with galactose

SCOP Domain Sequences for d1dzqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzqd_ b.29.1.1 (D:) Lectin {Furze (Ulex europaeus), UEA-II}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

SCOP Domain Coordinates for d1dzqd_:

Click to download the PDB-style file with coordinates for d1dzqd_.
(The format of our PDB-style files is described here.)

Timeline for d1dzqd_: