Lineage for d2d4ea_ (2d4e A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141736Species Thermus thermophilus HB8 [TaxId:300852] [255105] (1 PDB entry)
  8. 2141737Domain d2d4ea_: 2d4e A: [241499]
    automated match to d4ni4a_
    complexed with gol, na, nad

Details for d2d4ea_

PDB Entry: 2d4e (more details), 2.1 Å

PDB Description: Crystal Structure of the HpcC from Thermus Thermophilus HB8
PDB Compounds: (A:) 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase

SCOPe Domain Sequences for d2d4ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d4ea_ c.82.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
yadrvagiswetieevrrrlkerpalhfiagefvpsesgetfpsldpatnevlgvaargg
erevdraakaaheafqrwsrtkakerkryllriaeliekhadelavmecldagqvlrivr
aqvaraaenfafyaeyaehamedrtfpvdrdwlyytvrvpagpvgiitpwnaplmlstwr
iapalafgntvvlkpaewspftatklaeilkeadlppgvfnlvqgfgeeagaalvahplv
plltltgetetgkivmrnaadhlkrlspelggkspalvfadadleraldavvfqifsfng
erctassrllveekifedfvgkvverarairvghpldpetevgplihpehlqrvlgyvea
gkregarllvggeraktsfrgedlsrgnyllptvfvgenhmkiaqeeifgpvlvaipfkd
eeealrkandtkyglaayvftrdlerahrlaleleagmvylnshnvrhlptpfggvkgsg
drreggtyaldfytdlktialplrpphvpkfgk

SCOPe Domain Coordinates for d2d4ea_:

Click to download the PDB-style file with coordinates for d2d4ea_.
(The format of our PDB-style files is described here.)

Timeline for d2d4ea_: