SCOPe 2.05: Domain d2d2wa_: 2d2w A:

Lineage for d2d2wa_ (2d2w A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)

6. Protein automated matches [190243] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255024] (2 PDB entries)

8. Domain d2d2wa_: 2d2w A: [241498]
   automated match to d1jxsa_

Details for d2d2wa_

PDB Entry: 2d2w

PDB Description: solution structure and dynamics of the dna-binding domain of myocyte nuclear factor

PDB Compounds: (A:) Forkhead box protein K1

SCOPe Domain Sequences for d2d2wa_:

Sequence; same for both SEQRES and ATOM records:

>d2d2wa_ a.4.5.14 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eskppysyaqlivqaissaqdrqltlsgiyahitkhypyyrtadkgwqnsirhnlslnry
fikvprsqeepgkgsfwridpaseaklveqafrkrrqrgvs

Timeline for d2d2wa_:

• d2d2wa_ first appeared in SCOPe 2.04
  
• d2d2wa_ appears in SCOPe 2.06
  
• d2d2wa_ appears in the current release, SCOPe 2.08