| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins) |
| Protein automated matches [190243] (2 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [255024] (2 PDB entries) |
| Domain d2d2wa_: 2d2w A: [241498] automated match to d1jxsa_ |
PDB Entry: 2d2w (more details)
SCOPe Domain Sequences for d2d2wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2wa_ a.4.5.14 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eskppysyaqlivqaissaqdrqltlsgiyahitkhypyyrtadkgwqnsirhnlslnry
fikvprsqeepgkgsfwridpaseaklveqafrkrrqrgvs
Timeline for d2d2wa_: