SCOPe 2.06: Domain d2d2ab_: 2d2a B:

Lineage for d2d2ab_ (2d2a B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.124: HesB-like domain [89359] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.124.1: HesB-like domain [89360] (2 families)

5. Family b.124.1.0: automated matches [227171] (1 protein)
   not a true family

6. Protein automated matches [226886] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255100] (1 PDB entry)

8. Domain d2d2ab_: 2d2a B: [241497]
   automated match to d1x0ga_

Details for d2d2ab_

PDB Entry: 2d2a, 2.7 Å

PDB Description: crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters

PDB Compounds: (B:) SufA protein

SCOPe Domain Sequences for d2d2ab_:

Sequence, based on SEQRES records:

>d2d2ab_ b.124.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
sgtfnpqdfawqgltltpaaaihirelvakqpgmvgvrlgvkqtgcagfgyvldsvsepd
kddllfehdgaklfvplqampfidgtevdfvreglnqifkfhnpka

Sequence, based on observed residues (ATOM records):

>d2d2ab_ b.124.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
sgtfnpqdfawqgltltpaaaihirelvakqpgmvgvrlgvkqgfgyvldsvsepdkddl
lfehdgaklfvplqampfidgtevdfvreglnqifkfhnpka

Timeline for d2d2ab_:

• d2d2ab_ first appeared in SCOPe 2.04
  
• d2d2ab_ appears in SCOPe 2.05
  
• d2d2ab_ appears in SCOPe 2.07
  
• d2d2ab_ appears in the current release, SCOPe 2.08