Lineage for d2cwba_ (2cwb A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309372Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2309396Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2309587Family a.5.2.0: automated matches [254220] (1 protein)
    not a true family
  6. 2309588Protein automated matches [254501] (2 species)
    not a true protein
  7. 2309592Species Streptococcus sp. [TaxId:1306] [255096] (2 PDB entries)
  8. 2309594Domain d2cwba_: 2cwb A: [241493]
    automated match to d2daha1

Details for d2cwba_

PDB Entry: 2cwb (more details)

PDB Description: solution structure of the ubiquitin-associated domain of human bmsc- ubp and its complex with ubiquitin
PDB Compounds: (A:) chimera of Immunoglobulin G binding protein G and Ubiquitin-like protein SB132

SCOPe Domain Sequences for d2cwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwba_ a.5.2.0 (A:) automated matches {Streptococcus sp. [TaxId: 1306]}
gsqwqpqlqqlrdmgiqddelslralqatggdiqaalelifaggap

SCOPe Domain Coordinates for d2cwba_:

Click to download the PDB-style file with coordinates for d2cwba_.
(The format of our PDB-style files is described here.)

Timeline for d2cwba_: