SCOPe 2.08: Domain d2cuga1: 2cug A:8-82

Lineage for d2cuga1 (2cug A:8-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.0: automated matches [191473] (1 protein)
   not a true family

6. Protein automated matches [190750] (8 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255095] (1 PDB entry)

8. Domain d2cuga1: 2cug A:8-82 [241492]
   Other proteins in same PDB: d2cuga2, d2cuga3
   automated match to d1hdja_

Details for d2cuga1

PDB Entry: 2cug

PDB Description: solution structure of the j domain of the pseudo dnaj protein, mouse hypothetical mkiaa0962

PDB Compounds: (A:) mKIAA0962 protein

SCOPe Domain Sequences for d2cuga1:

Sequence; same for both SEQRES and ATOM records:

>d2cuga1 a.2.3.0 (A:8-82) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ilqslsaldfdpyrvlgvsrtasqadikkaykklarewhpdknkdpgaedrfiqiskaye
ilsneekrtnydhyg

Timeline for d2cuga1:

• d2cuga1 first appeared in SCOPe 2.04, called d2cuga_
  
• d2cuga1 appears in SCOPe 2.07