Lineage for d1dzqc_ (1dzq C:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663408Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)
  8. 663419Domain d1dzqc_: 1dzq C: [24149]

Details for d1dzqc_

PDB Entry: 1dzq (more details), 2.85 Å

PDB Description: lectin uea-ii complexed with galactose
PDB Compounds: (C:) ulex europaeus lectin II (uea-II)

SCOP Domain Sequences for d1dzqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzqc_ b.29.1.1 (C:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

SCOP Domain Coordinates for d1dzqc_:

Click to download the PDB-style file with coordinates for d1dzqc_.
(The format of our PDB-style files is described here.)

Timeline for d1dzqc_: