Lineage for d1dzqc_ (1dzq C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12521Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)
  8. 12532Domain d1dzqc_: 1dzq C: [24149]

Details for d1dzqc_

PDB Entry: 1dzq (more details), 2.85 Å

PDB Description: lectin uea-ii complexed with galactose

SCOP Domain Sequences for d1dzqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzqc_ b.29.1.1 (C:) Lectin {Furze (Ulex europaeus), UEA-II}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

SCOP Domain Coordinates for d1dzqc_:

Click to download the PDB-style file with coordinates for d1dzqc_.
(The format of our PDB-style files is described here.)

Timeline for d1dzqc_: