SCOPe 2.08: Domain d2ctra1: 2ctr A:8-82

Lineage for d2ctra1 (2ctr A:8-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.0: automated matches [191473] (1 protein)
   not a true family

6. Protein automated matches [190750] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255094] (10 PDB entries)

8. Domain d2ctra1: 2ctr A:8-82 [241489]
   Other proteins in same PDB: d2ctra2, d2ctra3
   automated match to d2o37a_

Details for d2ctra1

PDB Entry: 2ctr

PDB Description: solution structure of j-domain from human dnaj subfamily b menber 9

PDB Compounds: (A:) DnaJ homolog subfamily B member 9

SCOPe Domain Sequences for d2ctra1:

Sequence; same for both SEQRES and ATOM records:

>d2ctra1 a.2.3.0 (A:8-82) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syydilgvpksaserqikkafhklamkyhpdknkspdaeakfreiaeayetlsdanrrke
ydtlghsaftsgkgq

Timeline for d2ctra1:

• d2ctra1 first appeared in SCOPe 2.04, called d2ctra_
  
• d2ctra1 appears in SCOPe 2.07