![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) ![]() |
![]() | Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
![]() | Protein automated matches [226872] (13 species) not a true protein |
![]() | Species Aquifex aeolicus [TaxId:63363] [230623] (2 PDB entries) |
![]() | Domain d2ct8b2: 2ct8 B:347-497 [241487] Other proteins in same PDB: d2ct8a1, d2ct8b1 automated match to d2csxa2 protein/RNA complex; complexed with msp |
PDB Entry: 2ct8 (more details), 2.7 Å
SCOPe Domain Sequences for d2ct8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ct8b2 a.27.1.0 (B:347-497) automated matches {Aquifex aeolicus [TaxId: 63363]} laneignlysrvvnmahkflggevsgardeeyakiaqesiknyenymekvnfykaieeil kftsylnkyvdekqpwalnkerkkeelqkvlyalvdglfvlthllypitpnkmkealqml gekeflkelkpyskntyklgerkilfpkreg
Timeline for d2ct8b2: