SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ct8b1 (2ct8 B:1-346)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (46 species)
    not a true protein
  7. 2106032Species Aquifex aeolicus [TaxId:63363] [230619] (2 PDB entries)
  8. 2106034Domain d2ct8b1: 2ct8 B:1-346 [241486]
    Other proteins in same PDB: d2ct8a2, d2ct8b2
    automated match to d2csxa1
    protein/RNA complex; complexed with msp

Details for d2ct8b1

PDB Entry: 2ct8 (more details), 2.7 Å

PDB Description: Crystal structure of Aquifex aeolicus methionyl-tRNA synthetase complexed with tRNA(Met) and methionyl-adenylate anologue
PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2ct8b1:

Sequence, based on SEQRES records: (download)

>d2ct8b1 c.26.1.0 (B:1-346) automated matches {Aquifex aeolicus [TaxId: 63363]}
mtlmkkfyvttpiyyvndvphlghayttiaadtiaryyrlrdydvffltgtdehglkiqk
kaeelgispkelvdrnaerfkklweflkieytkfirttdpyhvkfvqkvfeecykrgdiy
lgeyegwycvgceefkseaelaedhtcpihqkkceyikepsyffrlskyqdkllelyekn
pefiqpdyrrneiisfvkqglkdlsvtrprsrvkwgipvpfdpehtiyvwfdalfnyisa
ledkveiywpadlhlvgkdilrfhtvywpaflmslgyelpkkvfahgwwtvegkkmsktl
gnvvdpyevvqeygldevryfllrevpfgqdgdfskkailnringe

Sequence, based on observed residues (ATOM records): (download)

>d2ct8b1 c.26.1.0 (B:1-346) automated matches {Aquifex aeolicus [TaxId: 63363]}
mtlmkkfyvttpiyyvndvphlghayttiaadtiaryyrlrdydvffltgtdehglkiqk
kaeelgispkelvdrnaerfkklweflkieytkfirttdpyhvkfvqkvfeecykrgdiy
lgeyekepsyffrlskyqdkllelyeknpefiqpdyrrneiisfvkqglkdlsvtrprsr
vkwgipvpfdpehtiyvwfdalfnyisaledkveiywpadlhlvgkdilrfhtvywpafl
mslgyelpkkvfahgwwtvegkkmsktlgnvvdpyevvqeygldevryfllrevpfgqdg
dfskkailnringe

SCOPe Domain Coordinates for d2ct8b1:

Click to download the PDB-style file with coordinates for d2ct8b1.
(The format of our PDB-style files is described here.)

Timeline for d2ct8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ct8b2