Lineage for d2ct8a2 (2ct8 A:347-497)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319167Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2319168Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2319221Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2319222Protein automated matches [226872] (13 species)
    not a true protein
  7. 2319223Species Aquifex aeolicus [TaxId:63363] [230623] (2 PDB entries)
  8. 2319224Domain d2ct8a2: 2ct8 A:347-497 [241485]
    Other proteins in same PDB: d2ct8a1, d2ct8b1
    automated match to d2csxa2
    protein/RNA complex; complexed with msp

Details for d2ct8a2

PDB Entry: 2ct8 (more details), 2.7 Å

PDB Description: Crystal structure of Aquifex aeolicus methionyl-tRNA synthetase complexed with tRNA(Met) and methionyl-adenylate anologue
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2ct8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ct8a2 a.27.1.0 (A:347-497) automated matches {Aquifex aeolicus [TaxId: 63363]}
laneignlysrvvnmahkflggevsgardeeyakiaqesiknyenymekvnfykaieeil
kftsylnkyvdekqpwalnkerkkeelqkvlyalvdglfvlthllypitpnkmkealqml
gekeflkelkpyskntyklgerkilfpkreg

SCOPe Domain Coordinates for d2ct8a2:

Click to download the PDB-style file with coordinates for d2ct8a2.
(The format of our PDB-style files is described here.)

Timeline for d2ct8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ct8a1