Lineage for d2ct8a1 (2ct8 A:1-346)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106032Species Aquifex aeolicus [TaxId:63363] [230619] (2 PDB entries)
  8. 2106033Domain d2ct8a1: 2ct8 A:1-346 [241484]
    Other proteins in same PDB: d2ct8a2, d2ct8b2
    automated match to d2csxa1
    protein/RNA complex; complexed with msp

Details for d2ct8a1

PDB Entry: 2ct8 (more details), 2.7 Å

PDB Description: Crystal structure of Aquifex aeolicus methionyl-tRNA synthetase complexed with tRNA(Met) and methionyl-adenylate anologue
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d2ct8a1:

Sequence, based on SEQRES records: (download)

>d2ct8a1 c.26.1.0 (A:1-346) automated matches {Aquifex aeolicus [TaxId: 63363]}
mtlmkkfyvttpiyyvndvphlghayttiaadtiaryyrlrdydvffltgtdehglkiqk
kaeelgispkelvdrnaerfkklweflkieytkfirttdpyhvkfvqkvfeecykrgdiy
lgeyegwycvgceefkseaelaedhtcpihqkkceyikepsyffrlskyqdkllelyekn
pefiqpdyrrneiisfvkqglkdlsvtrprsrvkwgipvpfdpehtiyvwfdalfnyisa
ledkveiywpadlhlvgkdilrfhtvywpaflmslgyelpkkvfahgwwtvegkkmsktl
gnvvdpyevvqeygldevryfllrevpfgqdgdfskkailnringe

Sequence, based on observed residues (ATOM records): (download)

>d2ct8a1 c.26.1.0 (A:1-346) automated matches {Aquifex aeolicus [TaxId: 63363]}
mtlmkkfyvttpiyyvndvphlghayttiaadtiaryyrlrdydvffltgtdehglkiqk
kaeelgispkelvdrnaerfkklweflkieytkfirttdpyhvkfvqkvfeecykrgdiy
lgeyekepsyffrlskyqdkllelyeknpefiqpdyrrneiisfvkqglkdlsvtrprsr
vkwgipvpfdpehtiyvwfdalfnyisaledkveiywpadlhlvgkdilrfhtvywpafl
mslgyelpkkvfahgwwtvegkkmsktlgnvvdpyevvqeygldevryfllrevpfgqdg
dfskkailnringe

SCOPe Domain Coordinates for d2ct8a1:

Click to download the PDB-style file with coordinates for d2ct8a1.
(The format of our PDB-style files is described here.)

Timeline for d2ct8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ct8a2